PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.032230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Nin-like
Protein Properties Length: 231aa    MW: 27498.2 Da    PI: 7.3264
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.032230.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.24.5e-25117163551
          RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                     + le+++ky++ pi +AAke++v+lTvLKr+CRq++I+RWPhRk+ks
  Cucsa.032230.1 117 LGLEEIKKYYHIPISEAAKEMNVGLTVLKRRCRQLNIMRWPHRKLKS 163
                     6799******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.03104186IPR003035RWP-RK domain
PfamPF020426.7E-23117163IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MDSNPQTFHN IPQFDFEWLH EDLFPFHNEL DELPPLDKDE FLDVNSSGSL LSFHLVDNNV  60
LEFESEFLSR EMDEIERKGL SSSTWKEEEE EEEEGEKRLR LMRNNNGNKR RKRSFVLGLE  120
EIKKYYHIPI SEAAKEMNVG LTVLKRRCRQ LNIMRWPHRK LKSYNSLIQN VKEMGLTNEV  180
KGLEEQKRLL VESPNMDLTH TTKRLRQACF KDKYRKNRRL RSNNIASLHH *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818501e-149LN681850.1 Cucumis melo genomic scaffold, anchoredscaffold01597.
GenBankLN7132601e-149LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008466842.11e-127PREDICTED: protein RKD4
TrEMBLE5GBA61e-127E5GBA6_CUCME; Transcription factor
STRINGSolyc03g083040.1.12e-45(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.11e-37RWP-RK domain-containing protein